PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00254.1.g00100.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 143aa    MW: 15970 Da    PI: 11.7599
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00254.1.g00100.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.57.8e-352073558
                        zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58
                                    +cp+C s++tkfCyy ny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+
  Zjn_sc00254.1.g00100.1.sm.mk 20 GEQCPQCASHDTKFCYYKNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKS 73
                                  579*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088426.2352175IPR003851Zinc finger, Dof-type
PfamPF027013.5E-302173IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-212268IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MQEVEHTAVT EANGNNGARG EQCPQCASHD TKFCYYKNYN TSQPRHFCRA CRRYWTLGGS  60
LRNVPIGGST RKSPLLAHPV GAAGEQAPRR LWRRQRGGAS HGPPQLAVRA RRCGAGAGGA  120
QRFRLRAWPR ASNAEWRGRC LRW
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824061e-68KC582406.1 Sorghum bicolor dof9 protein (dof9) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644658.19e-38PREDICTED: dof zinc finger protein DOF3.4-like
TrEMBLA0A096QUP89e-38A0A096QUP8_MAIZE; Uncharacterized protein
STRINGGRMZM2G061292_P013e-37(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-26DOF zinc finger protein 1